Skip to product information
1 of 1

My Store

IGF-1 LR3 - 1 MG

IGF-1 LR3 - 1 MG

Regular price $184.00 USD
Regular price Sale price $184.00 USD
Sale Sold out
Quantity

GF-1 LR3 (Insulin-like Growth Factor-1 Long Arg3) is a synthetic analog of human IGF-1, modified to enhance its stability and bioavailability in experimental settings. It contains an arginine substitution at position 3 and a 13-amino acid N-terminal extension, which significantly reduces its binding to IGF-binding proteins and increases its potency. IGF-1 LR3 is commonly studied for its roles in cell growth, muscle development, neuroprotection, and anabolic processes.

Amino Acid Sequence (Single-Letter Code):
MFPAMPLSSLFDKSKYCNALYQPPASSNRAHLCGLYALLRAYGIHEERGQRAQRGIVDECCFRSCDLRRLEMYCAPLKPTKAR

Molecular Formula: C400H625N111O115S9
Molecular Weight: ~9.2 kDa
Form: Lyophilized powder
Storage: Store at -20°C in a dry, dark place. Reconstituted solutions should be used promptly or stored per lab protocols.

Reconstitution:
Reconstitute with sterile water or appropriate buffer according to experimental needs.


Disclaimer:
For Research Use Only. Not for Human Consumption. This product is intended solely for scientific and laboratory research. It is not approved for medical, diagnostic, or therapeutic applications in humans or animals.

View full details