Skip to product information
1 of 1

My Store

LL-37 - 5 MG

LL-37 - 5 MG

Regular price $77.00 USD
Regular price Sale price $77.00 USD
Sale Sold out

LL-37 is a 37-amino acid cationic antimicrobial peptide derived from the C-terminal portion of the human cathelicidin antimicrobial protein (hCAP-18). It plays a key role in the innate immune system, exhibiting broad-spectrum antimicrobial activity against bacteria, viruses, and fungi. LL-37 is also involved in wound healing, inflammation regulation, and immune cell signaling. Due to its multifunctional properties, LL-37 is widely studied in the fields of immunology, infectious disease, and dermatology.

Amino Acid Sequence (Single-Letter Code):
[LL-37, 37 aa]

Molecular Formula: C204H322N56O46
Molecular Weight: ~4493.3 g/mol
Form: Lyophilized powder
Storage: Store at -20°C in a dry, dark environment. After reconstitution, store according to experimental protocol.

Reconstitution:
Reconstitute with sterile distilled water or a suitable buffer. Avoid repeated freeze-thaw cycles.


Disclaimer:
For Research Use Only. Not for Human Consumption. This product is intended solely for scientific and laboratory research. It is not approved for medical, diagnostic, or therapeutic applications in humans or animals.

View full details