Skip to product information
1 of 1

My Store

GLP-2 - 10 Vials

GLP-2 - 10 Vials

Regular price $2,170.00 USD
Regular price $2,970.00 USD Sale price $2,170.00 USD
Sale Sold out
Quantity

GLP-2 is a synthetic peptide designed specifically for laboratory research purposes. Structurally engineered to engage glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) receptors, GLP-2 facilitates studies exploring receptor interactions, signaling pathways, and metabolic processes in controlled experimental conditions.

Chemical Sequence:

HADGSFSDEMNTILDNLAARDFINWLIQTKITD

This product is intended strictly for in vitro laboratory research and is NOT approved for human or animal consumption. The purchaser must ensure compliance with all relevant laboratory protocols and regulatory guidelines.

View full details